PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016469439.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 425aa    MW: 48816.3 Da    PI: 8.5983
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016469439.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.41.7e-151694999
                    HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k++ l +pk f+ ++ +g k+e     +  +  ++W vk+  ++++    +++GW eFv++n+L+ gD++vF+++g+++f   v +f++
  XP_016469439.1 16 PGFKHA-LKIPKGFL-KYlNGRKHE---HAVLRRADKKWLVKV--NGYR----FEEGWAEFVEENDLQLGDMLVFRHEGNMKF--EVIIFDS 94
                    455555.********.554666555...56677899*******..6666....*************************99999..7777775 PP

2B3482.3e-15169249690
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     ++++ l+ g l+lp +fa+    ++ ++ +l ++de+ r W++kl+ + +++r+++++GW++F  +n Lk+g+ ++F+++++ ++
  XP_016469439.1 169 IRPYCLTCGYLRLPQQFANGL--SN-KKCDLFIRDERQRLWNLKLS-SDCKDRVYIGDGWRKFIADNCLKVGERIMFEVVSDGKT 249
                     6788889999*******9444..33.3348***************5.777788*************************8876443 PP

3B358.61.1e-18325404587
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     ++++++ k+ rl+l  +fa+++g+ +++  +++++de+ rsW+v+l    ++ ++ +t+GW +Fvkan++++gD++ F+l+++
  XP_016469439.1 325 TIKPYSIKRPRLYLQADFAKSNGLMNRR-CEMIITDEKQRSWSVQL--GPTGHHVAITRGWTKFVKANDVQVGDTFKFELINN 404
                     568999****************887655.59***************..****9**************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-22497IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.816795IPR003340B3 DNA binding domain
SuperFamilySSF1019367.26E-217101IPR015300DNA-binding pseudobarrel domain
CDDcd100174.44E-18893No hitNo description
SMARTSM010196.0E-151095IPR003340B3 DNA binding domain
PfamPF023625.5E-121893IPR003340B3 DNA binding domain
SuperFamilySSF1019361.24E-15161258IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.9E-17162258IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.984164261IPR003340B3 DNA binding domain
SMARTSM010192.7E-9164261IPR003340B3 DNA binding domain
PfamPF023622.0E-13168250IPR003340B3 DNA binding domain
CDDcd100173.91E-12172258No hitNo description
SuperFamilySSF1019362.16E-19316413IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.6E-20316413IPR015300DNA-binding pseudobarrel domain
CDDcd100171.23E-16320414No hitNo description
PROSITE profilePS5086313.366321415IPR003340B3 DNA binding domain
SMARTSM010191.6E-14322419IPR003340B3 DNA binding domain
PfamPF023627.7E-17325404IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MKVRPVKPHF FKPIQPGFKH ALKIPKGFLK YLNGRKHEHA VLRRADKKWL VKVNGYRFEE  60
GWAEFVEEND LQLGDMLVFR HEGNMKFEVI IFDSSHCDRE YAEYLQEEEA ATPTAHTFGE  120
TSKNFEFKGN TDDVIEIPSP DINSSDEDSS HAEAATDKHV GHSHFICTIR PYCLTCGYLR  180
LPQQFANGLS NKKCDLFIRD ERQRLWNLKL SSDCKDRVYI GDGWRKFIAD NCLKVGERIM  240
FEVVSDGKTE STWKFHVTDA ETPKQKFQDL RANASLHPEG KKPDLDANRY STQGLRIETS  300
DMTAPKAQVP ASTSANNAYP HFISTIKPYS IKRPRLYLQA DFAKSNGLMN RRCEMIITDE  360
KQRSWSVQLG PTGHHVAITR GWTKFVKAND VQVGDTFKFE LINNGTIPIA YFHCKYSGKD  420
TKQSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016469439.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X2
TrEMBLK4CIB01e-129K4CIB0_SOLLC; Uncharacterized protein
STRINGSolyc08g006210.1.11e-128(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.15e-40B3 family protein